SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000301717 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301717
Domain Number 1 Region: 93-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-52
Family SPRY domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSP00000301717
Domain Number - Region: 275-311
Classification Level Classification E-value
Superfamily SOCS box-like 0.00445
Family SOCS box-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301717   Gene: ENSG00000162032   Transcript: ENST00000301717
Sequence length 355
Comment pep:known chromosome:GRCh37:16:1826750:1831517:-1 gene:ENSG00000162032 transcript:ENST00000301717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRPRNSRAWHFVLSAARRDADARAVALAGSTNWGYDSDGQHSDSDSDPEYSTLPPSIP
SAVPVTGESFCDCAGQSEASFCSSLHSAHRGRDCRCGEEDEYFDWVWDDLNKSSATLLSC
DNRKVSFHMEYSCGTAAIRGTKELGEGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYRH
TFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCI
GVAATKLQNKRFYPMVCSTAARSSMKVTRSCASATSLQYLCCHRLRQLRPDSGDTLEGLP
LPPGLKQVLHNKLGWVLSMSCSRRKAPVSDPQAATSAHPSSREPRPCQRKRCRRT
Download sequence
Identical sequences Q6PJ21
gi|27552770|ref|NP_543137.2| 9606.ENSP00000301717 ENSP00000301717 ENSP00000457206 ENSP00000301717 ENSP00000301717 ENSP00000457206 NP_001311010.1.87134 NP_001311010.1.92137 NP_543137.2.87134 NP_543137.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]