SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000301744 from Homo sapiens 75_37

(show help)
Strong hits

Sequence:	ENSP00000301744
Domain Number 1	Region: 193-249
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	9.29e-20
Family	Classic zinc finger, C2H2	0.013
Further Details:

Domain Number 2	Region: 155-206
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000000000116
Family	Classic zinc finger, C2H2	0.0095
Further Details:

Domain Number 3	Region: 339-391
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000000127
Family	Classic zinc finger, C2H2	0.019
Further Details:

Domain Number 4	Region: 234-283
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000000466
Family	Classic zinc finger, C2H2	0.023
Further Details:

Domain Number 5	Region: 10-54
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	0.0000000017
Family	KRAB domain (Kruppel-associated box)	0.0099
Further Details:

Domain Number 6	Region: 377-421
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00000000194
Family	Classic zinc finger, C2H2	0.01
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSP00000301744 Gene: ENSG00000167981 Transcript: ENST00000301744
Sequence length	424
Comment	pep:known chromosome:GRCh37:16:3486104:3493542:-1 gene:ENSG00000167981 transcript:ENST00000301744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MASMPPTPEAQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTKESLEDAALMGEEGKPE INQQLSLESMELDELALEKYPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKRRVISLL VTIENHTPLVELSEYLGTNTLSEILDSPWEGAKNVYKCPECDQNFSDHSYLVLHQKIHSG EKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHSHLSRHMNSHVKEKPY TCSICGRGFMWLPGLAQHQKSHSAENTYESTNCDKHFNEKPNLALPEETFVSGPQYQHTK CMKSFRQSLYPALSEKSHDEDSERCSDDGDNFFSFSKFKPLQCPDCDMTFPCFSELISHQ NIHTEERPHKCKTCEESFALDSELACHQKSHMLAEPFKCTVCGKTFKSNLHLITHKRTHI KNTT
Download sequence
Identical sequences	Q96LX8 9606.ENSP00000301744 gi\|22748967\|ref\|NP_689670.1\| ENSP00000301744 ENSP00000301744 ENSP00000301744 NP_689670.1.87134 NP_689670.1.92137

SEARCH