SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000304676 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000304676
Domain Number 1 Region: 229-288
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.02e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000304676   Gene: ENSG00000168874   Transcript: ENST00000306279
Sequence length 321
Comment pep:known chromosome:GRCh37:2:85981017:86015189:1 gene:ENSG00000168874 transcript:ENST00000306279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGL
RDRTHRLQPVPVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKRCFALGAVGPG
LPTPPPPPPPAPQSQAPGGPEAQPFREPGLRPRILLCAPPARPAPSAPPAPPAPPESTVR
PAPPTRPGESSYSSISHVIYNNHQDSSASPRKRPGEATAASSEIKALQQTRRLLANARER
TRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFS
ECVQRCTRTLQAEGRAKKRKE
Download sequence
Identical sequences Q96SQ7
ENSP00000304676 9606.ENSP00000304676 NP_116216.2.87134 NP_116216.2.92137 ENSP00000304676 ENSP00000304676 gi|226498192|ref|NP_116216.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]