SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000305926 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000305926
Domain Number 1 Region: 892-921
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000014
Family A20-like zinc finger 0.025
Further Details:      
 
Weak hits

Sequence:  ENSP00000305926
Domain Number - Region: 26-63
Classification Level Classification E-value
Superfamily UBA-like 0.000383
Family TAP-C domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000305926   Gene: ENSG00000169918   Transcript: ENST00000307050
Sequence length 926
Comment pep:known chromosome:GRCh37:15:31775329:31947542:-1 gene:ENSG00000169918 transcript:ENST00000307050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSVLPNPTSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAAL
SDYEQLRQVHTANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISH
ASSAIVSLARSHVASECNNEQFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVAL
EQAGRLNWWSTVCTSCKRLLPLATTGDGNCLLHAASLGMWGFHDRDLVLRKALYTMMRTG
AEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVY
ESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPPNRCHCSPLV
LAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARL
AHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDS
VCSNSNSNNGKNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVH
GKMGRANSANGKNGDSAERGKEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASP
AEKGGGPRGDAWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMIGYYLTS
AQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPETEGVPVPERASPGPPTQLVLK
LKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQSVIHVQASGAR
DEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGT
AGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGR
AETEHYCSYCYREELRRRREARGARP
Download sequence
Identical sequences Q8TE49
NP_570971.1.87134 NP_570971.1.92137 9606.ENSP00000305926 ENSP00000305926 ENSP00000305926 gi|18702331|ref|NP_570971.1| HT6304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]