SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000305956 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000305956
Domain Number 1 Region: 11-384
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.84e-104
Family SepSecS-like 0.00000000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000305956   Gene: ENSG00000109618   Transcript: ENST00000302922
Sequence length 422
Comment pep:known chromosome:GRCh37:4:25121627:25162204:-1 gene:ENSG00000109618 transcript:ENST00000302922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTSYGCFWRRFIHGIGRSGDISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFV
VPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELR
TDLKAVEAKVQELGPDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQS
SKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQEISKMYPGRASASPS
LDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKT
LDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHTNNYPCAYLNAASA
IGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTEDVDIEEMALKLDNVLLDTYQDA
SS
Download sequence
Identical sequences 9606.ENSP00000305956 ENSP00000305956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]