SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000308334 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308334
Domain Number 1 Region: 117-193
Classification Level Classification E-value
Superfamily RNI-like 0.000000128
Family Cyclin A/CDK2-associated p19, Skp2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308334   Gene: ENSG00000125375   Transcript: ENST00000311459
Sequence length 215
Comment pep:known chromosome:GRCh37:14:50779359:50792705:1 gene:ENSG00000125375 transcript:ENST00000311459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCAVSEQRLTCADQMMPFGKISQQLCGVKKLPWSCDSRYFWGWLNAVFNKVDYDRIRDV
GPDRAASEWLLRCGAMVRYHGQERWQKDYNHLPTGPLDKYKIQAIDATDSCIMSIGFDHM
EGLEHVEKIRLCKCHYIEDDCLLRLSQLENLQKTILEMEIISCGNITDKGIIALRHLRNL
KYLLLSDLPGVREKENLVQAFKTALPSLELKLQLK
Download sequence
Identical sequences Q99766
ENSP00000308334 NP_001003803.1.87134 NP_001003803.1.92137 ENSP00000308334 gi|51558774|ref|NP_001003803.1| 9606.ENSP00000308334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]