SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000308753 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308753
Domain Number 1 Region: 184-347
Classification Level Classification E-value
Superfamily RNI-like 3.14e-45
Family 28-residue LRR 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308753   Gene: ENSG00000138594   Transcript: ENST00000308580
Sequence length 352
Comment pep:known chromosome:GRCh37:15:52121827:52204335:1 gene:ENSG00000138594 transcript:ENST00000308580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPFRKDLEKYKDLDEDELLGNLSETELKQLETVLDDLDPENALLPAGFRQKNQTSKST
TGPFDREHLLSYLEKEALEHKDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELE
EALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEP
PNPTNVEESLKRTKENDAHLVEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSLAATRSN
DPVATAFAEMLKVNKTLKSLNVESNFITGVGILALIDALRDNETLAELKIDNQRQQLGTA
VELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ
Download sequence
Identical sequences Q9NYL9
gi|7657649|ref|NP_055362.1| ENSP00000308753 ENSP00000438909 ENSP00000308753 ENSP00000438909 NP_055362.1.87134 NP_055362.1.92137 XP_016877576.1.92137 XP_016877577.1.92137 ENSP00000308753 9606.ENSP00000308753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]