SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000308976 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308976
Domain Number 1 Region: 103-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000178
Family VWC domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSP00000308976
Domain Number - Region: 51-111
Classification Level Classification E-value
Superfamily FnI-like domain 0.0023
Family Fibronectin type I module 0.036
Further Details:      
 
Domain Number - Region: 172-217
Classification Level Classification E-value
Superfamily FnI-like domain 0.023
Family VWC domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308976   Gene: ENSG00000174453   Transcript: ENST00000312504
Sequence length 222
Comment pep:known chromosome:GRCh37:2:215275789:215443683:1 gene:ENSG00000174453 transcript:ENST00000312504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAG
TTIIPAGIEVKVDECNICHCHNGDWWKPAQCSKRECQGKQTV
Download sequence
Identical sequences A0A096N8K0 A0A2J8STP9 A0A2K5CL02 A0A2K5N5Y9 A0A2K5PUK7 A0A2K5YDB7 A0A2K6EF87 A0A2K6TQC1 B2RUY7 G1R6G4 G3RJ39 G7N8U3 G7PLD0 H0WP12 H2QJC8
ENSNLEP00000008786 ENSPTRP00000022031 ENSNLEP00000008786 ENSP00000308976 ENSPANP00000008931 NP_001073969.1.87134 NP_001073969.1.92137 XP_001083194.1.72884 XP_002812863.1.23681 XP_003254085.1.23891 XP_003785024.1.62490 XP_003812561.1.60992 XP_003925624.1.74449 XP_004033210.1.27298 XP_005574256.1.63531 XP_007964352.1.81039 XP_011823275.1.47321 XP_011903265.1.92194 XP_012301794.1.9421 XP_012506923.1.63892 XP_012612234.1.48125 XP_017390478.1.71028 XP_526017.1.37143 ENSGGOP00000015710 9606.ENSP00000308976 ENSGGOP00000015710 gi|122937446|ref|NP_001073969.1| ENSP00000308976 ENSOGAP00000003601 ENSP00000308976 ENSOGAP00000003601 ENSPTRP00000022031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]