SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000309302 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309302
Domain Number 1 Region: 367-608
Classification Level Classification E-value
Superfamily RNI-like 1.22e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.041
Further Details:      
 
Domain Number 2 Region: 71-138
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000207
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309302   Gene: ENSG00000173120   Transcript: ENST00000308783
Sequence length 620
Comment pep:known chromosome:GRCh37:11:67007518:67023822:1 gene:ENSG00000173120 transcript:ENST00000308783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPAPRLTPVRPAAASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQ
SCVLRQCLAPRLPHSVTCSLCGEVDQNEETQDFEKKLMECCICNEIVHPGCLQMDGEGLL
NEELPNCWECPKCYQEDSSEKAQKRKMEESDEEAVQAKVLRPLRSCDEPLTPPPHSPTSM
LQLIHDPVSPRGMVTRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSG
KKELSEVEKAKIRGSYLTVTLQRPTKELHGTSIVPKLQAITASSANLRHSPRVLVQHCPA
RTPQRGDEEGLGGEEEEEEEEEEEDDSAEEGGAARLNGRGSWAQDGDESWMQREVWMSVF
RYLSRRELCECMRVCKTWYKWCCDKRLWTKIDLSRCKAIVPQALSGIIKRQPVSLDLSWT
NISKKQLTWLVNRLPGLKDLLLAGCSWSAVSALSTSSCPLLRTLDLRWAVGIKDPQIRDL
LTPPADKPGQDNRSKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSS
NLLTAVGSSTRYSLTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFIS
DLSINSLYCLSDEKLIQKIS
Download sequence
Identical sequences ENSP00000309302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]