SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000311202 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311202
Domain Number 1 Region: 41-136
Classification Level Classification E-value
Superfamily POZ domain 6.28e-25
Family Tetramerization domain of potassium channels 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311202   Gene: ENSG00000174943   Transcript: ENST00000308768
Sequence length 329
Comment pep:known chromosome:GRCh37:16:29916333:29937530:-1 gene:ENSG00000174943 transcript:ENST00000308768 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSAEASGPAAAAAPSLEAPKPSGLEPGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLT
GQDTMLKAMFSGRVEVLTDAGGWVLIDRSGRHFGTILNYLRDGSVPLPESTRELGELLGE
ARYYLVQGLIEDCQLALQQKRETLSPLCLIPMVTSPREEQQLLASTSKPVVKLLHNRSNN
KYSYTSTSDDNLLKNIELFDKLALRFHGRLLFLKDVLGDEICCWSFYGQGRKIAEVCCTS
IVYATEKKQTKVEFPEARIFEETLNILIYETPRGPDPALLEATGGAAGAGGAGRGEDEEN
REHRVRRIHVRRHITHDERPHGQQIVFKD
Download sequence
Identical sequences H2QAV9 M3Z9T1 Q8WZ19
ENSP00000311202 ENSP00000455785 ENSNLEP00000009250 9598.ENSPTRP00000013636 9606.ENSP00000311202 ENSNLEP00000009250 GO.44539 HR3072 ENSP00000311202 ENSP00000455785 ENSP00000311202 NP_849194.1.87134 NP_849194.1.92137 XP_003282046.1.23891 XP_510914.2.37143 ENSPTRP00000013636 ENSPTRP00000013636 gi|30578412|ref|NP_849194.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]