SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000311554 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311554
Domain Number 1 Region: 38-352
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.64e-90
Family Cystathionine synthase-like 0.000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311554   Gene: ENSG00000116761   Transcript: ENST00000346806
Sequence length 361
Comment pep:known chromosome:GRCh37:1:70877066:70904887:1 gene:ENSG00000116761 transcript:ENST00000346806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEY
SRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRY
FRQVASEFGLKISFVDCSKIKLLEAAITPETKRPLALGADISMYSATKYMNGHSDVVMGL
VSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNP
WVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGF
ESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSH
S
Download sequence
Identical sequences ENSP00000311554 gi|25453487|ref|NP_714964.2| NP_714964.2.87134 NP_714964.2.92137 ENSP00000311554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]