SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000314774 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000314774
Domain Number 1 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000314774   Gene: ENSG00000179111   Transcript: ENST00000317814
Sequence length 225
Comment pep:known chromosome:GRCh37:17:8024889:8027402:-1 gene:ENSG00000179111 transcript:ENST00000317814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFS
ALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAWSPSLC
SPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
Download sequence
Identical sequences Q9BYE0
gi|145207994|ref|NP_115969.2| 9606.ENSP00000314774 ENSP00000314774 ENSP00000314774 NP_115969.2.87134 NP_115969.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]