SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000315112 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000315112
Domain Number 1 Region: 781-850
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000109
Family IBR domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 65-166
Classification Level Classification E-value
Superfamily PUG domain-like 0.000000000000471
Family PUG domain 0.0044
Further Details:      
 
Domain Number 3 Region: 698-763
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000565
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 4 Region: 861-933
Classification Level Classification E-value
Superfamily RING/U-box 0.00000989
Family RING finger domain, C3HC4 0.038
Further Details:      
 
Domain Number 5 Region: 352-377
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000589
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number 6 Region: 574-613
Classification Level Classification E-value
Superfamily UBA-like 0.0000975
Family UBA domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSP00000315112
Domain Number - Region: 301-327
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00157
Family Ran binding protein zinc finger-like 0.0029
Further Details:      
 
Domain Number - Region: 409-434
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00302
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 
Domain Number - Region: 215-246
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00983
Family TFIIH p44 subunit cysteine-rich domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000315112   Gene: ENSG00000092098   Transcript: ENST00000324103
Sequence length 1072
Comment pep:known chromosome:GRCh37:14:24616588:24629870:1 gene:ENSG00000092098 transcript:ENST00000324103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCN
AHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLLED
KVEDDMLQLSEFDPLLREIAPGPLTTPSVPGSTPGPCFLCGSAPGTLHCPSCKQALCPAC
DHLFHGHPSRAHHLRQTLPGVLQGTHLSPSLPASAQPRPQSTSLLALGDSSLSSPNPASA
HLPWHCAACAMLNEPWAVLCVACDRPRGCKGLGLGTEGPQGTGGLEPDLARGRWACQSCT
FENEAAAVLCSICERPRLAQPPSLVVDSRDAGICLQPLQQGDALLASAQSQVWYCIHCTF
CNSSPGWVCVMCNRTSSPIPAQHAPRPYASSLEKGPPKPGPPRRLSAPLPSSCGDPEKQR
QDKMREEGLQLVSMIREGEAAGACPEEIFSALQYSGTEVPLQWLRSELPYVLEMVAELAG
QQDPGLGAFSCQEARRAWLDRHGNLDEAVEECVRTRRRKVQELQSLGFGPEEGSLQALFQ
HGGDVSRALTELQRQRLEPFRQRLWDSGPEPTPSWDGPDKQSLVRRLLAVYALPSWGRAE
LALSLLQETPRNYELGDVVEAVRHSQDRAFLRRLLAQECAVCGWALPHNRMQALTSCECT
ICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYAL
FHKKLTEGVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRS
CEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSG
CYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAG
ARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATL
YEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTEEVPLGQSIPRRRK
Download sequence
Identical sequences Q96EP0
gi|109150431|ref|NP_060469.4| HR3592 NP_060469.4.87134 NP_060469.4.92137 ENSP00000315112 ENSP00000315112 ENSP00000315112 9606.ENSP00000315112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]