SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000316114 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000316114
Domain Number - Region: 223-267
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0171
Family Tudor domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000316114   Gene: ENSG00000176476   Transcript: ENST00000317058
Sequence length 293
Comment pep:known chromosome:GRCh37:16:28565247:28603111:1 gene:ENSG00000176476 transcript:ENST00000317058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLR
GLYTTAKADAEAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLM
TLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEV
VSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQ
TTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK
Download sequence
Identical sequences A0A096NHT6 A0A1D5QHN1 A0A2K5F540 A0A2K5M5Z1 A0A2K5QSZ1 A0A2K5WKH8 A0A2K5YE56 A0A2K6MFV3 A0A2K6RRU2 F7E6K6 H2NQJ3 K7AT32 Q96ES7
9544.ENSMMUP00000029402 9598.ENSPTRP00000013546 9600.ENSPPYP00000008178 9606.ENSP00000316114 ENSP00000316114 ENSMMUP00000014921 ENSMMUP00000029402 ENSP00000316114 ENSPTRP00000013546 ENSPTRP00000013546 ENSPPYP00000008178 NP_001244374.1.72884 NP_612423.1.87134 NP_612423.1.92137 XP_002756069.1.60252 XP_002826329.1.23681 XP_009248873.1.23681 XP_009248874.1.23681 XP_009248875.1.23681 XP_010386996.1.97406 XP_011837771.1.47321 XP_011943931.1.92194 XP_014197208.1.60992 XP_014981380.1.72884 XP_014981381.1.72884 XP_015297618.1.63531 XP_015297619.1.63531 XP_015297620.1.63531 XP_015297621.1.63531 XP_016784291.1.37143 XP_017374627.1.71028 XP_017719900.1.44346 XP_021528018.1.9421 ENSPANP00000012534 HR6529 ENSMMUP00000014921 gi|19923935|ref|NP_612423.1| ENSP00000316114 ENSCJAP00000012147 ENSPPYP00000008178 ENSCJAP00000012147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]