SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000317327 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317327
Domain Number 1 Region: 398-410,441-637
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 4.59e-34
Family Cofactor-dependent phosphoglycerate mutase 0.017
Further Details:      
 
Domain Number 2 Region: 278-343
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000147
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 14-72
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000167
Family UBA domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSP00000317327
Domain Number - Region: 74-133
Classification Level Classification E-value
Superfamily LigT-like 0.0392
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317327   Gene: ENSG00000160185   Transcript: ENST00000319294
Sequence length 661
Comment pep:known chromosome:GRCh37:21:43824024:43867791:1 gene:ENSG00000160185 transcript:ENST00000319294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGETQLYAKVSNKLKSRSSPSLLEPLLAMGFPVHTALKALAATGRKTAEEALAWLHDH
CNDPSLDDPIPQEYALFLCPTGPLLEKLQEFWRESKRQCAKNRAHEVFPHVTLCDFFTCE
DQKVECLYEALKRAGDRLLGSFPTAVPLALHSSISYLGFFVSGSPADVIREFAMTFATEA
SLLAGTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKYCSVKPCTKQLHLTLAHK
FYPHHQRTLEQLARAIPLGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDELTLSPG
DYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMYTFSLATDLN
SRKDGEASSRCSGEFLPQTARSLSSLQALQATVARKSVLVVRHGERVDQIFGKAWLQQCS
TPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFA
SPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNID
TDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLL
GLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISG
N
Download sequence
Identical sequences P57075
ENSP00000317327 gi|9507221|ref|NP_061834.1| NP_061834.1.87134 NP_061834.1.92137 ENSP00000317327 ENSP00000317327 9606.ENSP00000317327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]