SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000317333 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317333
Domain Number 1 Region: 110-171
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317333   Gene: ENSG00000178403   Transcript: ENST00000313341
Sequence length 272
Comment pep:known chromosome:GRCh37:4:113434672:113437328:-1 gene:ENSG00000178403 transcript:ENST00000313341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAG
QGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
LPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSP
ASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI
Download sequence
Identical sequences A0A2I3T5C2 Q9H2A3
ENSP00000317333 NP_076924.1.87134 NP_076924.1.92137 XP_001142826.2.37143 ENSP00000317333 gi|31077092|ref|NP_076924.1| ENSP00000317333 9606.ENSP00000317333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]