SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000318185 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000318185
Domain Number 1 Region: 150-279
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000863
Family 28-residue LRR 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318185   Gene: ENSG00000116212   Transcript: ENST00000319223
Sequence length 428
Comment pep:known chromosome:GRCh37:1:54412026:54433841:1 gene:ENSG00000116212 transcript:ENST00000319223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYLSSENHLDPGPIYMRENGQLHMVNLALDGVRSSLQKPRPFRLFPKGFSVELCMNRE
DDTARKEKTDHFIFTYTREGNLRYSAKSLFSLVLGFISDNVDHIDSLIGFPEQIAEKLFS
AAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLRNRYLVISEKLEEIKSFRELTCLDL
SCCKLGDEHELLEHLTNEALSSVTQLHLKDNCLSDAGVRKMTAPVRVMKRGLENLTLLDL
SCNPEITDAGIGYLFSFRKLNCLDISGTGLKDIKTVKHKLQTHIGLVHSKVPLKEFDHSN
CKTEGWADQIVLQWERVTAEAVKPRETSEPRAAAQRFYGKRSRAEAPLKCPLADTHMNSS
EKLQFYKEKAPDCHGPVLKHEAISSQESKKSKKRPFEESETEQNNSSQPSKQKYVCLAVE
DWDLLNSY
Download sequence
Identical sequences Q9Y546
ENSP00000318185 ENSP00000360421 gi|16506299|ref|NP_443172.1| NP_001243338.1.87134 NP_001243338.1.92137 NP_443172.1.87134 NP_443172.1.92137 XP_006710390.1.92137 XP_006710391.1.92137 ENSP00000318185 ENSP00000360421 ENSP00000318185 9606.ENSP00000318185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]