SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000318799 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000318799
Domain Number 1 Region: 241-317
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.32e-16
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318799   Gene: ENSG00000180828   Transcript: ENST00000321870
Sequence length 381
Comment pep:known chromosome:GRCh37:8:65492814:65496181:1 gene:ENSG00000180828 transcript:ENST00000321870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSS
PLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLP
AGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKA
AEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGGSSSSSSSSSKKSKEQ
KALRLNINARERRRMHDLNDALDELRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQAL
EEMRRLVAYLNQGQAISAASLPSSAAAAAAAAALHPALGAYEQAAGYPFSAGLPPAASCP
EKCALFNSVSSSLCKQCTEKP
Download sequence
Identical sequences Q8NFJ8
gi|22748877|ref|NP_689627.1| ENSP00000318799 ENSP00000318799 9606.ENSP00000318799 ENSP00000318799 NP_689627.1.87134 NP_689627.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]