SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000319222 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000319222
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000319222   Gene: ENSG00000197302   Transcript: ENST00000316491
Sequence length 126
Comment pep:known chromosome:GRCh37:16:31724555:31772886:1 gene:ENSG00000197302 transcript:ENST00000316491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLTFRDVAIEFSREEWEHLDSDQKLLYGDVMLENYGNLVSLGLAVSKPDLITFLEQRK
EPWNVKSAETVAIQPDIFSHDTQGLLRKKLIEASFQKVILDGYGSCGPQNLNLRKEWESE
GKIILW
Download sequence
Identical sequences Q7Z2F6
GO.35097 gi|195963403|ref|NP_001124385.1| 9606.ENSP00000319222 ENSP00000319222 ENSP00000319222 NP_001124385.1.87134 NP_001124385.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]