SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000319231 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000319231
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000661
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000319231   Gene: ENSG00000181649   Transcript: ENST00000314222
Sequence length 152
Comment pep:known chromosome:GRCh37:11:2949503:2950685:-1 gene:ENSG00000181649 transcript:ENST00000314222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDC
VERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPA
APAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Download sequence
Identical sequences Q53GA4
ENSP00000319231 gi|4507705|ref|NP_003302.1| 9606.ENSP00000319231 ENSP00000319231 ENSP00000319231 ENSP00000483602 NP_003302.1.87134 NP_003302.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]