SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000320520 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000320520
Domain Number 1 Region: 155-256
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000298
Family 28-residue LRR 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000320520   Gene: ENSG00000178026   Transcript: ENST00000318753
Sequence length 315
Comment pep:known chromosome:GRCh37:22:24981588:24989030:-1 gene:ENSG00000178026 transcript:ENST00000318753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARLGRRAGPEAGSEAGAAAGCGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQD
LGLERTLLPDILYRDVAFLNPVDPISHDLLVNLARDLQCPKKDYELWKSSDKICRQLIYH
LTPHSKQQQGSSLRQRKTQSCLKSSLQKTLLAGETVDLSGIPLSTQDVQHITRYLSSHGA
VLAVLDLSFTGLSDELLHLLLPSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTTKFPA
LAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGLDLEPEGSAAGATTPASTWDS
TAAGLGPEPQACCAR
Download sequence
Identical sequences Q2VPJ9 Q3KRG1
NP_997527.2.87134 NP_997527.2.92137 gi|134288867|ref|NP_997527.2| ENSP00000320520 9606.ENSP00000320520 ENSP00000320520 ENSP00000320520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]