SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000320913 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000320913
Domain Number 1 Region: 44-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000320913   Gene: ENSG00000108788   Transcript: ENST00000346833
Sequence length 214
Comment pep:known chromosome:GRCh37:17:40719090:40725257:1 gene:ENSG00000108788 transcript:ENST00000346833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDA
IKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKD
VTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQE
LSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences A0A1D5QWC0 A0A2I3LE91 A0A2J8RF46 A0A2K5IHL1 A0A2K5L0X0 A0A2K5VRM1 A0A2K5XDB0 A0A2K6BFF9 A0A2K6LGZ3 A0A2K6PTG6 H2QD26
ENSP00000320913 ENSP00000320913 ENSPTRP00000015682 NP_937848.1.87134 NP_937848.1.92137 XP_001110298.1.72884 XP_001163548.1.37143 XP_003813944.1.60992 XP_005584311.1.63531 XP_008010814.1.81039 XP_009250008.1.23681 XP_010384363.1.97406 XP_011723396.1.29376 XP_011785087.1.43180 XP_011854183.1.47321 XP_011902107.1.92194 XP_017712081.1.44346 gi|38201614|ref|NP_937848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]