SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000321139 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321139
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.51e-69
Family BAR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 362-478
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.05e-44
Family Pyk2-associated protein beta ARF-GAP domain 0.0002
Further Details:      
 
Domain Number 3 Region: 221-325
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-27
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 4 Region: 598-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-24
Family Ankyrin repeat 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321139   Gene: ENSG00000131584   Transcript: ENST00000353662
Sequence length 759
Comment pep:known chromosome:GRCh37:1:1227764:1243269:-1 gene:ENSG00000131584 transcript:ENST00000353662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEAGKAYVSTSRLFVSGVRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRS
VRQQLQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRK
CFRHLALDYVLQINVLQAKKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAEL
DQLVIDSAVEKREMERKHAAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNA
FKTWNRRWFSIQNSQLVYQKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCM
LQADSEKLRQAWVQAVQASIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKG
ESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDS
WEPELLKLMCELGNSAVNQIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAP
MAPALEAPRRWRVQKCLRPHSSPRAPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLF
CPDELDSLFSYFDAGAAGAGPRKGAESEESSGEADGDTEAEAWGLADVRELHPGLLAHRA
ARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCEFLLQNGADVNQRDSR
GRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAANADIVTLLRLARMAE
EMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES
Download sequence
Identical sequences ENSP00000321139 ENSP00000321139 NYSGRC-16945966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]