SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000321365 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321365
Domain Number 1 Region: 227-292
Classification Level Classification E-value
Superfamily XPC-binding domain 1.31e-21
Family XPC-binding domain 0.0000365
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.45e-21
Family Ubiquitin-related 0.0000166
Further Details:      
 
Domain Number 3 Region: 302-360
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000134
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 152-203
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000222
Family UBA domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321365   Gene: ENSG00000179262   Transcript: ENST00000316856
Sequence length 362
Comment pep:novel chromosome:GRCh37:19:13056690:13064437:1 gene:ENSG00000179262 transcript:ENST00000316856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVP
IRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAARE
DKSPSEESAPTTSPESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERV
VAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAGENPLEFLRDQPQF
QNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGEV
GAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFD
DE
Download sequence
Identical sequences A0A2J8LV56
ENSP00000321365 NP_001257291.1.87134 NP_001257291.1.92137 XP_016790698.1.37143 XP_018870747.1.27298 ENSP00000321365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]