SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000322887 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000322887
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-36
Family Canonical RBD 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000322887   Gene: ENSG00000099622   Transcript: ENST00000320936
Sequence length 172
Comment pep:known chromosome:GRCh37:19:1269336:1273171:1 gene:ENSG00000099622 transcript:ENST00000320936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD
RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Download sequence
Identical sequences A0A0D9RIJ2 A0A2I2Z1A4 A0A2J8R9S5 A0A2K5JEL8 A0A2K6C4D1 A0A2K6KT08 A0A2K6NMP4 G2HHD6 I0FHP5 Q14011 Q4R5L7 Q53XX5 Q5RF83
9606.ENSP00000322887 NP_001124692.1.23681 NP_001248245.1.72884 NP_001271.1.87134 NP_001271.1.92137 XP_006722700.1.92137 XP_007992780.1.81039 XP_010373205.1.97406 XP_011747293.1.29376 XP_011747303.1.29376 XP_015296000.1.63531 XP_015296001.1.63531 XP_017728521.1.44346 XP_018870758.1.27298 XP_018870759.1.27298 ENSP00000322887 ENSP00000465779 ENSP00000466110 ENSP00000466207 ENSP00000468788 gi|4502847|ref|NP_001271.1| ENSMMUP00000029100 ENSP00000322887 ENSP00000465779 ENSP00000466110 ENSP00000466207 ENSP00000468224 ENSP00000468788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]