SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000324246 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000324246
Domain Number 1 Region: 193-262
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.22e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSP00000324246
Domain Number - Region: 8-79
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0994
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000324246   Gene: ENSG00000187098   Transcript: ENST00000314557
Sequence length 413
Comment pep:known chromosome:GRCh37:3:69985738:70014819:1 gene:ENSG00000187098 transcript:ENST00000314557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDH
VMPPVPGSSAPNSPMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVI
DDIISLESSYNEEILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPN
IKRELTESEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTI
LKASVDYIRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLC
SPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSV
PTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC
Download sequence
Identical sequences ENSP00000324246 GO.42972 ENSP00000324246 gi|38156697|ref|NP_937801.1| NP_937801.1.87134 NP_937801.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]