SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000324443 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000324443
Domain Number 1 Region: 285-352
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.57e-16
Family HLH, helix-loop-helix DNA-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000324443   Gene: ENSG00000187098   Transcript: ENST00000314589
Sequence length 504
Comment pep:known chromosome:GRCh37:3:69915430:70014798:1 gene:ENSG00000187098 transcript:ENST00000314589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALRVQMFMPCSFESLYLSSAEHPGASKPPISSSSMTSRILLRQQLMREQMQEQERREQ
QQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPTKYHIQQAQR
QQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEGF
YKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMANTLP
VSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTESEARALAKERQKKDNHNLIERR
RRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKKLE
HANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADL
TCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSS
VSPGASKTSSRRSSMSMEETEHTC
Download sequence
Identical sequences ENSP00000324443 NP_937820.1.87134 NP_937820.1.92137 XP_003811625.1.60992 gi|38156703|ref|NP_937820.1| ENSP00000324443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]