SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000326695 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000326695
Domain Number 1 Region: 80-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.84e-17
Family TRASH domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000326695   Gene: ENSG00000163867   Transcript: ENST00000317538
Sequence length 170
Comment pep:novel chromosome:GRCh37:1:35482845:35497506:-1 gene:ENSG00000163867 transcript:ENST00000317538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIA
QQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITRHSSPACLPPPPKKTCTNCSKYKILNIPFYFTFFLVCILFSSNILLIL
Download sequence
Identical sequences A0A2I2YZM3
ENSP00000326695 ENSP00000362430 ENSP00000326695 ENSP00000362430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]