SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000327055

Domain assignment for ENSP00000327055 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000327055
Domain Number 1	Region: 14-233
Classification Level	Classification	E-value
Superfamily	WD40 repeat-like	2.41e-54
Family	WD40-repeat	0.00025
Further Details:

Domain Number 2	Region: 229-273
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.0000000000484
Family	SOCS box-like	0.003
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000327055 Gene: ENSG00000109046 Transcript: ENST00000348811
Sequence length	275
Comment	pep:known chromosome:GRCh37:17:25621157:25639913:1 gene:ENSG00000109046 transcript:ENST00000348811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MASFPPRVNEKEIGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNM MKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSP DGALLATASYDTRVYIWDPHNGDILMEFGHLFPPPTPIFAGGANDRWVRSVSFSHDGLHV ASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPS LQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI
Download sequence
Identical sequences	A0A024QZ36 A0A2J8TM69 NP_599027.1.87134 NP_599027.1.92137 ENSP00000327055 gi\|20143912\|ref\|NP_599027.1\| ENSP00000327055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]