SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000327316 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000327316
Domain Number 1 Region: 33-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-44
Family ets domain 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000327316   Gene: ENSG00000117036   Transcript: ENST00000326786
Sequence length 143
Comment pep:known chromosome:GRCh37:1:157102937:157108266:-1 gene:ENSG00000117036 transcript:ENST00000326786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGCSIVEKPEGGGGYQFPDWAYKTESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGE
YGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKL
VMPNYPFINIRSSGKIQTLLVGN
Download sequence
Identical sequences A0A2J8K5I1 A0A2J8VH38
ENSP00000327316 gi|20270188|ref|NP_005231.1| NP_005231.1.87134 NP_005231.1.92137 ENSP00000327316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]