SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000327675 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000327675
Domain Number 1 Region: 199-420
Classification Level Classification E-value
Superfamily RNI-like 2.62e-22
Family 28-residue LRR 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000327675   Gene: ENSG00000185028   Transcript: ENST00000328278
Sequence length 514
Comment pep:novel chromosome:GRCh37:5:191626:195468:1 gene:ENSG00000185028 transcript:ENST00000328278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTMRSLRFISAEALVSHPQVARQSLDSVAHNLYPLLFKASYLLEQAEVTRAVLGRWPLE
EFRLGALLGPGADHPQDLRDRTCRACLEALVRGLADHVLQDRSRRRLRVADLTGIRDVQV
QRCPCGRALGRWGRTQLLARTCCELQAEPLAAGRPVEVLADLFVTEGNFEAVVQALRPAG
PAPLRVHCPSFRADSLSPSQLLHVLRLAGPGALRKLEVVHNVRLHAGHVQQLLAQVGFPR
LASLTLPTKAFDAPPTYASTPDGEDPLLASIARELSKMAQLTELSVAFSTLTGKIPTLLG
PLQTPLRVLDLANCALNHTDMAFLADCAHAAHLEVLDLSGHNLVSLYPSTFFRLLSQASR
TLRILTLEECGIVDSHVGMLILGLSPCHRLRQLKFLGNPLSARALRRLFTALCELPELRC
IEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSF
DPDIQETSNELGAFLLQAFKTALENFSRALKQIE
Download sequence
Identical sequences A6NHZ5
gi|122937351|ref|NP_001073947.1| ENSP00000327675 HR6099 NP_001073947.1.87134 NP_001073947.1.92137 ENSP00000327675 ENSP00000327675 9606.ENSP00000327675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]