SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000333667 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000333667
Domain Number 1 Region: 41-501
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.06e-184
Family GABA-aminotransferase-like 0.0000000000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000333667   Gene: ENSG00000182199   Transcript: ENST00000328923
Sequence length 504
Comment pep:known chromosome:GRCh37:12:57623110:57628714:1 gene:ENSG00000182199 transcript:ENST00000328923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYFSLFWAARPLQRCGQLVRMAIRAQHSNAAQTQTGEANRGWTGQESLSDSDPEMWELL
QREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQ
RRALEAFDLDPAQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDV
KRISATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREV
CDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVD
PKTGREIPYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARA
MADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAIT
PGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQ
RLANLRQRVEQFARAFPMPGFDEH
Download sequence
Identical sequences P34897 V9HW06
NP_005403.2.87134 NP_005403.2.92137 ENSP00000333667 gi|19923315|ref|NP_005403.2| 9606.ENSP00000333667 ENSP00000333667 ENSP00000333667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]