SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000334410 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334410
Domain Number 1 Region: 166-424
Classification Level Classification E-value
Superfamily RNI-like 4.12e-19
Family 28-residue LRR 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334410   Gene: ENSG00000204481   Transcript: ENST00000334600
Sequence length 474
Comment pep:putative chromosome:GRCh37:1:13668743:13673511:-1 gene:ENSG00000204481 transcript:ENST00000334600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFRRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPETMSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKHLRKSLKIIYLNSIQQLEIRNMSWPRLIRKLRCYLKEMKNLRKLVFS
RCHHSMSDNELEGRLVTKFSSVFLRLEHLQLLKIKLITFFSGHLEQLIRCLQNPLENLEL
TYGYLLEEDMKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIAASLETLILEGCQ
IHYSQLSAILPGLSHCSQLTTFYFGRNCMSMGALKDLLCHTSGLSKLSLETYPAPEESLN
SLVRVDWEIFALLRAELMCTLREVRQPKRIFIGPTPCPSCGSSPSEELELHLCC
Download sequence
Identical sequences A6NFR9
ENSP00000341333 ENSP00000334410 ENSP00000334410 NP_001019832.2.87134 NP_001019832.2.92137 HR6143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]