SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000334983 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000334983
Domain Number 1 Region: 15-122,218-394
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 5.58e-109
Family Pyruvate kinase 0.000000000682
Further Details:      
 
Domain Number 2 Region: 398-530
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.19e-45
Family Pyruvate kinase, C-terminal domain 0.000000868
Further Details:      
 
Domain Number 3 Region: 117-218
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 9.59e-30
Family Pyruvate kinase beta-barrel domain 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334983   Gene: ENSG00000067225   Transcript: ENST00000335181
Sequence length 531
Comment pep:known chromosome:GRCh37:15:72491373:72523547:-1 gene:ENSG00000067225 transcript:ENST00000335181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET
LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR
TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL
ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV
FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE
IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM
LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS
FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
Download sequence
Identical sequences A0A2I2YRU7 H2Q9R1 P14618 V9HWB8
9598.ENSPTRP00000012389 ENSP00000334983 NP_002645.3.87134 NP_002645.3.92137 XP_001175100.1.37143 XP_004056483.1.27298 XP_005254502.1.92137 XP_008970134.1.60992 XP_008970135.1.60992 XP_018865985.1.27298 ENSPTRP00000012388 ENSP00000334983 ENSP00000334983 ENSPTRP00000012389 gi|33286418|ref|NP_002645.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]