SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000336661 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000336661
Domain Number 1 Region: 137-307,472-497
Classification Level Classification E-value
Superfamily RNI-like 2.51e-33
Family 28-residue LRR 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000336661   Gene: ENSG00000160838   Transcript: ENST00000337428
Sequence length 559
Comment pep:known chromosome:GRCh37:1:156890442:156902886:1 gene:ENSG00000160838 transcript:ENST00000337428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEQSAPGASPRAPRPGTQKSSGAVTKKGERAAKEKPATVLPPVGEEEPKSPEEYQCSG
VLETDFAELCTRWGYTDFPKVVNRPRPHPPFVPSASLSEKATLDDPRLSGSCSLNSLESK
YVFFRPTIQVELEQEDSKSVKEIYIRGWKVEERILGVFSKCLPPLTQLQAINLWKVGLTD
KTLTTFIELLPLCSSTLRKVSLEGNPLPEQSYHKLMALDSTIAHLSLRNNNIDDRGAQLL
GQALSTLHSCNRTLVSLNLGFNHIGDEGAGYIADGLRLNRSLLWLSLAHNRIQDKGALKL
AEVLRAFELTHTEVVERRRLLLEKGTQERSRSPSSSRHGDSKTDREKSQMVGISNSALVD
KTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDATKAGKGKVTIPEQ
KPSRAKGIKIGSREKRSILLESELVVEATEVVNPLLEPVEHRDGKVFMPGNKVLLHLNLI
RNRITEVGLEGFLATVQYQMQFSKAKSASKGPVGLLWLSLAKNCFAPQCPAYAIIQELML
PRDPIKAKLREDEAMAFFP
Download sequence
Identical sequences Q8N4P6
ENSP00000336661 NP_653303.2.87134 NP_653303.2.92137 GO.34923 ENSP00000336661 gi|163965441|ref|NP_653303.2| 9606.ENSP00000336661 ENSP00000336661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]