SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000337889 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337889
Domain Number 1 Region: 53-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337889   Gene: ENSG00000123933   Transcript: ENST00000337190
Sequence length 209
Comment pep:known chromosome:GRCh37:4:2249159:2264021:-1 gene:ENSG00000123933 transcript:ENST00000337190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNE
LEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQ
QEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDA
DDHYSLQSGTGGDSGFGPHCRRLGRPALS
Download sequence
Identical sequences K7DEU0 Q14582
ENSP00000337889 NP_006445.1.87134 NP_006445.1.92137 ENSP00000337889 9606.ENSP00000337889 GO.56038 HR6454 ENSP00000337889 gi|5453734|ref|NP_006445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]