SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000338340 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000338340
Domain Number - Region: 37-81
Classification Level Classification E-value
Superfamily UBC-like 0.000309
Family UBC-related 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000338340   Gene: ENSG00000182247   Transcript: ENST00000335798
Sequence length 92
Comment pep:known chromosome:GRCh37:3:23244653:23632070:1 gene:ENSG00000182247 transcript:ENST00000335798 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCRLPSEQESITVILTAKV
Download sequence
Identical sequences A0A2J8NPE5 A0A2J8WZA0 F8W8F0
ENSP00000338340 ENSP00000338340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]