SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000339666 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000339666
Domain Number 1 Region: 85-352
Classification Level Classification E-value
Superfamily RNI-like 1.49e-33
Family 28-residue LRR 0.0059
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily DEATH domain 4e-21
Family Caspase recruitment domain, CARD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000339666   Gene: ENSG00000091106   Transcript: ENST00000342905
Sequence length 359
Comment pep:known chromosome:GRCh37:2:32449524:32490801:-1 gene:ENSG00000091106 transcript:ENST00000342905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILK
KGSESCNLFLKSLKEWNYPLFQDLNGQSGLTDSLGNLKNLTKLIMDNIKMNEEDAIKLAE
GLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKILAQNLH
NLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLLKHLEE
VPQLVKLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGVFENLK
QLVFFDFSTKEFLPDPALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFKLVTA
Download sequence
Identical sequences ENSP00000339666 NP_001289433.1.87134 NP_001289433.1.92137 ENSP00000339666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]