SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000340626

Domain assignment for ENSP00000340626 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000340626
Domain Number 1	Region: 132-273
Classification Level	Classification	E-value
Superfamily	PH domain-like	1.33e-42
Family	Third domain of FERM	0.000000424
Further Details:

Domain Number 2	Region: 35-131
Classification Level	Classification	E-value
Superfamily	Second domain of FERM	9.55e-32
Family	Second domain of FERM	0.00000179
Further Details:

Domain Number 3	Region: 420-498
Classification Level	Classification	E-value
Superfamily	Moesin tail domain	3.92e-20
Family	Moesin tail domain	0.0029
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000340626 Gene: ENSG00000186575 Transcript: ENST00000353887
Sequence length	507
Comment	pep:known chromosome:GRCh37:22:29999736:30090800:1 gene:ENSG00000186575 transcript:ENST00000353887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEVKKQILDEKIYCPPEASVLLAS YAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEA EMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRN ISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKA QAREEKARKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADL LAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTEEEKRLMEQKVLEAEVLALKMAEE SERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFNLIGD SLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHN ENSDRGGSSKHNTIKKPQAQGRRPICI
Download sequence
Identical sequences	A0A024R1D9 A0A2I2YXH3 A0A2K5P512 A0A2K5WC56 A0A2K5XBN2 A0A2K6D2A4 A0A2K6NIA1 F6RPZ9 ENSP00000335652 ENSP00000340626 gi\|32967264\|ref\|NP_861968.1\| gi\|32967514\|ref\|NP_861969.1\| NP_861968.1.87134 NP_861968.1.92137 NP_861969.1.87134 NP_861969.1.92137 XP_011851099.1.47321 XP_011851100.1.47321 ENSP00000335652 ENSP00000340626 ENSMMUP00000013516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]