SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000340633 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340633
Domain Number 1 Region: 160-235
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  ENSP00000340633
Domain Number - Region: 226-266
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0197
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340633   Gene: ENSG00000105698   Transcript: ENST00000343550
Sequence length 279
Comment pep:known chromosome:GRCh37:19:35759881:35770718:1 gene:ENSG00000105698 transcript:ENST00000343550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTD
QSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRR
RDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQETFKEAERL
QMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ
Download sequence
Identical sequences A0A2J8RRB7 K7B2N4
gi|46877105|ref|NP_997174.1| ENSP00000340633 NP_997174.1.87134 NP_997174.1.92137 ENSP00000340633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]