SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000341333 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341333
Domain Number 1 Region: 162-376
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000126
Family Cyclin A/CDK2-associated p19, Skp2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341333   Gene: ENSG00000204481   Transcript: ENST00000344998
Sequence length 426
Comment pep:known chromosome:GRCh37:1:13668269:13673511:-1 gene:ENSG00000204481 transcript:ENST00000344998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIQAPPRLLELAGQSLLRDQALSISAMEELPRVLYLPLFMEAFRRRHFQTLTVMVQAWP
FTCLPLGSLMKTLHLETLKALLEGLHMLLTQKDRPRRWKLQVLDLRDVDENFWARWPGAW
ALSCFPETMSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYLFQWVYQRRGLVHL
CCSKLVNYLTPIKHLRKSLKIIYLNSIQQLEIRNMSWPRLIRKLRCYLKEMKNLRKLVFS
RCLQNPLENLELTYGYLLEEDMKCLSQYPSLGYLKHLNLSYVLLFRISLEPLGALLEKIA
ASLETLILEGCQIHYSQLSAILPGLSHCSQLTTFYFGRNCMSMGALKDLLCHTSGLSKLS
LETYPAPEESLNSLVRVDWEIFALLRAELMCTLREVRQPKRIFIGPTPCPSCGSSPSEEL
ELHLCC
Download sequence
Identical sequences Q5SWL7
gi|153792140|ref|NP_001093324.1| HR6140 9606.ENSP00000341333 ENSP00000341333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]