SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000342482 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000342482
Domain Number 1 Region: 17-61
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000342482   Gene: ENSG00000125952   Transcript: ENST00000341653
Sequence length 83
Comment pep:known chromosome:GRCh37:14:65472892:65569105:-1 gene:ENSG00000125952 transcript:ENST00000341653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKGTK
MKLTLPPVFPYEHLPFPTVFCHG
Download sequence
Identical sequences A0A2I3ST87
NP_932061.1.87134 NP_932061.1.92137 XP_003314431.1.37143 XP_008976016.1.60992 ENSP00000342482 gi|37577142|ref|NP_932061.1| ENSP00000342482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]