SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Homo sapiens 75_37 > ENSP00000343408

Domain assignment for ENSP00000343408 from Homo sapiens 75_37

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSP00000343408
Domain Number 1	Region: 40-260
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	1.1e-51
Family	Ankyrin repeat	0.00017
Further Details:

Domain Number 2	Region: 259-301
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.00000144
Family	SOCS box-like	0.0045
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSP00000343408 Gene: ENSG00000165192 Transcript: ENST00000344384
Sequence length	302
Comment	pep:known chromosome:GRCh37:X:15300441:15332681:-1 gene:ENSG00000165192 transcript:ENST00000344384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MLQLTGENEKNCEVSERIRRSGPWKEISFGDYICHTFQGDCWADRSPLHEAAAQGRLLAL KTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCS GSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLY VACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQG KSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLL YQ
Download sequence
Identical sequences	ENSP00000343408 ENSP00000343408 ENSP00000445465 gi\|60218887\|ref\|NP_001012428.1\| NP_001012428.1.87134 NP_001012428.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]