SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344470 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344470
Domain Number 1 Region: 66-282
Classification Level Classification E-value
Superfamily RNI-like 2.98e-48
Family 28-residue LRR 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344470   Gene: ENSG00000122477   Transcript: ENST00000342895
Sequence length 335
Comment pep:known chromosome:GRCh37:1:100614409:100643771:-1 gene:ENSG00000122477 transcript:ENST00000342895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENVVCTGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTRED
GRVILKIEKEEWKTLPSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISE
IPPGIGLLTRLQELILSYNKIKTVPKELSNCASLEKLELAVNRDICDLPQELSNLLKLTH
LDLSMNDFTTIPLAVLNMPALEWLDMGSNKLEQLPDTIERMQNLHTLWLQRNEITCLPQT
ISNMKNLGTLVLSNNKLQDIPVCMEEMANLRFVNFRDNPLKLKVSLPPSEGTDEEEEREL
FGLQFMHTYIQESRRRADHQVNGSTTLPISINTDG
Download sequence
Identical sequences Q96DD0
gi|21389431|ref|NP_653221.1| 9606.ENSP00000344470 NP_001243315.1.87134 NP_001243315.1.92137 NP_001243316.1.87134 NP_001243316.1.92137 NP_653221.1.87134 NP_653221.1.92137 ENSP00000344470 ENSP00000359156 GO.39974 ENSP00000344470 ENSP00000359156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]