SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344758 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344758
Domain Number 1 Region: 325-675
Classification Level Classification E-value
Superfamily RNI-like 2.2e-48
Family 28-residue LRR 0.076
Further Details:      
 
Domain Number 2 Region: 101-159
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000091
Family VWC domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344758   Gene: ENSG00000106823   Transcript: ENST00000344604
Sequence length 699
Comment pep:known chromosome:GRCh37:9:95257594:95298337:-1 gene:ENSG00000106823 transcript:ENST00000344604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVLFCFFLLIIFQTDFGKNEEIPRKQRRKIYHRRLRKSSTSHKHRSNRQLGIQQTTV
FTPVARLPIVNFDYSMEEKFESFSSFPGVESSYNVLPGKKGHCLVKGITMYNKAVWSPEP
CTTCLCSDGRVLCDETMCHPQRCPQTVIPEGECCPVCSATVSYSLLSGIALNDRNEFSGD
SSEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEEDTEQKRETPESRNQGQLY
SEGDSRGGDRKQRPGEERRLAHQQQRQGREEEEDEEEEGEEGEEDEEDEEDPVRGDMFRM
PSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPD
EAFNGLPNLERLDLSKNNITSSGIGPKAFKLLKKLMRLNMDGNNLIQIPSQLPSTLEELK
VNENNLQAIDEESLSDLNQLVTLELEGNNLSEANVNPLAFKPLKSLAYLRLGKNKFRIIP
QGLPGSIEELYLENNQIEEITEICFNHTRKINVIVLRYNKIEENRIAPLAWINQENLESI
DLSYNKLYHVPSYLPKSLLHLVLLGNQIERIPGYVFGHMEPGLEYLYLSFNKLADDGMDR
VSFYGAYHSLRELFLDHNDLKSIPPGIQEMKALHFLRLNNNKIRNILPEEICNAEEDDDS
NLEHLHLENNYIKIREIPSYTFSCIRSYSSIVLKPQNIK
Download sequence
Identical sequences O94769
NP_001384.1.87134 NP_001384.1.92137 ENSP00000344758 9606.ENSP00000344758 gi|4557543|ref|NP_001384.1| ENSP00000344758 ENSP00000344758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]