SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000344923 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000344923
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 2.35e-171
Family Sema domain 0.0000000000000105
Further Details:      
 
Domain Number 2 Region: 502-553
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000667
Family Plexin repeat 0.0000388
Further Details:      
 
Domain Number 3 Region: 611-693
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000638
Family C1 set domains (antibody constant domain-like) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000344923   Gene: ENSG00000187764   Transcript: ENST00000339861
Sequence length 738
Comment pep:novel chromosome:GRCh37:9:91975702:92112953:-1 gene:ENSG00000187764 transcript:ENST00000339861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCTPIRGLLMALAVMFGTAMAFAPIPRITWEHREVHLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDRTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGNRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPPTATCVALHQTESPSR
GLIQEMSGDASVCPASSPKPLPPPGSSSLSCLGHVGDRRLSSPWTPWPASGAGPDSSSRV
SLLPPFLSDQAQHVHALGNFYLFCQATGPADIRFVWEKNGRALETCVPVQTHALPDGRAH
ALSWLQDAIRESAEYRCSVLSSAGNKTSKVQVAVMRPEVTHQERWTRELSAWRAVAGEHD
RMMQSWRKAWESCSKDTL
Download sequence
Identical sequences ENSP00000344923 ENSP00000391733 ENSP00000411981 ENSP00000343418 ENSP00000344923 ENSP00000391733 ENSP00000411981 NP_001135759.1.87134 NP_001135759.1.92137 gi|214010220|ref|NP_001135759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]