SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345213 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345213
Domain Number 1 Region: 80-168,219-254
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.79e-42
Family Inhibitor of apoptosis (IAP) repeat 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345213   Gene: ENSG00000101197   Transcript: ENST00000342412
Sequence length 280
Comment pep:known chromosome:GRCh37:20:61867235:61871847:1 gene:ENSG00000101197 transcript:ENST00000342412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDR
AVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
Download sequence
Identical sequences NP_071444.1.87134 NP_071444.1.92137 ENSP00000345213 ENSP00000345213 gi|11545910|ref|NP_071444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]