SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345282 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345282
Domain Number 1 Region: 86-514
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.92e-68
Family AAT-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345282   Gene: ENSG00000166123   Transcript: ENST00000340124
Sequence length 523
Comment pep:known chromosome:GRCh37:16:46918290:46965209:1 gene:ENSG00000166123 transcript:ENST00000340124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAAALVRRGCGPRTPSSWGRSQSSAAAEASAVLKVRPERSRRERILTLESMNPQVKAV
EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPN
LLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDN
IYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENC
WALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADE
VYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLH
PEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLT
EDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVP
GSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEKYA
Download sequence
Identical sequences A0A024R6R2 A0A2J8VY02 G3RJK4 Q8TD30
NP_597700.1.87134 NP_597700.1.92137 XP_004057650.1.27298 ENSGGOP00000015896 9606.ENSP00000345282 ENSP00000345282 ENSGGOP00000015896 gi|19263340|ref|NP_597700.1| ENSP00000345282 ENSP00000345282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]