SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345420 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345420
Domain Number 1 Region: 76-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.63e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345420   Gene: ENSG00000187855   Transcript: ENST00000342331
Sequence length 173
Comment pep:known chromosome:GRCh37:12:108168162:108170421:1 gene:ENSG00000187855 transcript:ENST00000342331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMETRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQ
YLPVPLDSAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAID
YIKHLQELLERQAWGLEGAAGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
Download sequence
Identical sequences gi|206597481|ref|NP_982260.2| NP_982260.2.87134 NP_982260.2.92137 ENSP00000345420 9606.ENSP00000345420 ENSP00000345420 ENSP00000345420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]