SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345575 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345575
Domain Number 1 Region: 139-248
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-32
Family Chaperone J-domain 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSP00000345575
Domain Number - Region: 34-76
Classification Level Classification E-value
Superfamily TPR-like 0.00307
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number - Region: 346-393
Classification Level Classification E-value
Superfamily YbjQ-like 0.0235
Family YbjQ-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345575   Gene: ENSG00000148719   Transcript: ENST00000338820
Sequence length 409
Comment pep:known chromosome:GRCh37:10:74092588:74114907:-1 gene:ENSG00000148719 transcript:ENST00000338820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLRARLPATRRRVAQPFARPASPSLVPRSGSAMESNKDEAERCISIALKAIQSNQPDR
ALRFLEKAQRLYPTPRVRALIESLNQKPQTAGDQPPPTDTTHATHRKAGGTDAPSANGEA
GGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPG
ATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHGHGDFHRGFEADISPEDLFNM
FFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLM
VSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFSEEYTGSSLKTVERNVEDDYIANLR
NNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCSRLSEVQASLHG
Download sequence
Identical sequences J3KPS0
ENSP00000345575 ENSP00000378363 9606.ENSP00000345575 gi|194306640|ref|NP_001002762.2| gi|194306642|ref|NP_060096.3| ENSP00000345575 ENSP00000378363 ENSP00000378363 NP_001002762.2.87134 NP_001002762.2.92137 NP_060096.3.87134 NP_060096.3.92137 XP_005269989.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]